
High-purity Sermorelin Acetate (5mg) in lyophilised form, water-soluble and ideal for hormone-related research. For laboratory use only—not for human consumption. Store refrigerated or frozen. Discreet UK-based shipping worldwide.
£34.99
Sermorelin Acetate is a synthetic peptide analogue of growth hormone–releasing hormone (GHRH), designed for advanced research into pituitary function, hormone signaling, and endocrine regulation. With a purity of ≥98%, this peptide provides consistent reliability for high-level laboratory investigations.
✅ ≥98% Purity – Research Grade
🔬 Designed for Endocrinology and Hormonal Pathway Studies
🧪 Precision-Manufactured Lyophilised Peptide
Product Details:
• Name: Sermorelin Acetate
• Quantity: 5mg
• Catalogue Number: UKSERM2
• Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S
• Molecular Weight: 3358.9 g/mol
• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ (acetate salt)
• Form: Lyophilised Solid
Storage & Handling:
Sermorelin Acetate is supplied as a stable lyophilised powder to maintain integrity and maximize shelf life. Please consult our detailed guidelines for reconstitution and storage.
Note: This product is strictly for laboratory research use only. Not for human consumption or clinical application.
This product is intended as a research chemical, and is limited to scientific research and education only. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mis-labled as a drug, food or cosmetic.
The whole process of ordering through wolverine peptides was excellent. Fast delivery, quality products and the stack included everything you would need!
Would absolutely recommend ordering this stack!
Excellent product and service. Fast shipping, well-packaged, and arrived in perfect condition. Very satisfied and will definitely order again!
I heard good recommendations about the peptides on this website.
I’m based in US and because of the high quality of the products I will be ordering from here.
Also they are very helpful if you have a question .
MN,Colorado,US.
.
I ordered the BPC-157 and the Retatrutide. Everything came well packaged, and the products were of high quality. Thanks!
best product
Fast shipping, secure and discreet packaging, really happy with the products, great vaue.
Arrived promptly and great quality.
Thanks!
Excellent quality and fast shipping. Everything arrived well-packaged and exactly as described.
Great experience from start to finish. Easy ordering process and top-notch customer service.
£151.82 Original price was: £151.82.£139.99Current price is: £139.99.
£110.89 Original price was: £110.89.£99.99Current price is: £99.99.
£75.91 Original price was: £75.91.£68.49Current price is: £68.49.
£166.34 Original price was: £166.34.£129.74Current price is: £129.74.
| Cookie name | Active |
|---|---|
| woocommerce_cart_hash | |
| wp_woocommerce_session_68d5d32e3852c170f425ad13ac45768d |