💕 Valentines Sale now On! 💕 Take 15% off your order with code: VALENTINES. Offer ends 15th Feb 2026
1280 products sold

Sermorelin Acetate 5mg

Endocrine Research with High-Purity Sermorelin Acetate

5MG

High-purity Sermorelin Acetate (5mg) in lyophilised form, water-soluble and ideal for hormone-related research. For laboratory use only—not for human consumption. Store refrigerated or frozen. Discreet UK-based shipping worldwide.

£34.99

116 in stock

Highest purity verified. Ships fast and Discreetly from the U.K.

Multi-Buy Discounts

Explore Endocrine Research with High-Purity Sermorelin Acetate – 5mg

Sermorelin Acetate is a synthetic peptide analogue of growth hormone–releasing hormone (GHRH), designed for advanced research into pituitary function, hormone signaling, and endocrine regulation. With a purity of ≥98%, this peptide provides consistent reliability for high-level laboratory investigations.

✅ ≥98% Purity – Research Grade
🔬 Designed for Endocrinology and Hormonal Pathway Studies
🧪 Precision-Manufactured Lyophilised Peptide

Product Details:
Name: Sermorelin Acetate
Quantity: 5mg
Catalogue Number: UKSERM2
Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular Weight: 3358.9 g/mol
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ (acetate salt)
Form: Lyophilised Solid

Storage & Handling:
Sermorelin Acetate is supplied as a stable lyophilised powder to maintain integrity and maximize shelf life. Please consult our detailed guidelines for reconstitution and storage.

Note: This product is strictly for laboratory research use only. Not for human consumption or clinical application.

Mixing Guide

Sermorelin Acetate Mixing Guide 1ml sterile water = 10 x 0.1ml / 500mcg 2ml sterile water = 20 x 0.1ml / 250mcg 5mg = 5000mcg

Research

This section provides general information on the properties and potential applications of peptides for research purposes only. We encourage researchers to explore available studies and resources to expand their understanding. Please note that all products are strictly not intended for human consumption or clinical use. We strongly recommend consulting with qualified professionals and conducting independent research before use in any laboratory setting.

Usage

This product is intended as a research chemical, and is limited to scientific research and education only. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mis-labled as a drug, food or cosmetic.

Leave a review

Leave us a review and receive a 15% off discount code!

Reviews

Great quality with fast delivery

Mo

Excellent quality products with fast delivery

Dan

High end professional great stuff

Alan

Arrived promptly and great quality.

Thanks!

amira

Excellent quality and fast shipping. Everything arrived well-packaged

Sa

Great experience. I live in the US and my order came in 5 days. I will be reordering when needed.

Christian V

The whole process of ordering through wolverine peptides was excellent. Fast delivery, quality products and the stack included everything you would need!

Would absolutely recommend ordering this stack!

Ben

Excellent product and service. Fast shipping, well-packaged, and arrived in perfect condition. Very satisfied and will definitely order again!

Abdulaziz A

I heard good recommendations about the peptides on this website.

I’m based in US and because of the high quality of the products I will be ordering from here.

Also they are very helpful if you have a question .

MN,Colorado,US.

Maria Nechtman

.

Shay

Related Products

250MG

£169.99

Select options This product has multiple variants. The options may be chosen on the product page
5MG

£27.49

Select options This product has multiple variants. The options may be chosen on the product page

Product Stacks

All products sold on this site are for in-vitro research only.

We use cookies to personalise content and ads, to provide social media features and to analyse our traffic. We also share information about your use of our site with our social media, advertising and analytics partners. View more
Cookies settings
Accept
Decline
Privacy & Cookie policy
Privacy & Cookies policy
Cookie name Active
wp_woocommerce_session_68d5d32e3852c170f425ad13ac45768d

This Privacy Policy describes how Wolverine Peptides ("we," "our," or "us") collects, uses, and protects personal information obtained from visitors and users of our website: https://wolverinepeptides.co.uk.

We are committed to safeguarding your privacy. Please read this policy carefully to understand how we handle your personal data.

Information We Collect

We may collect and process the following types of information:

1. Personal Information

    • Name and contact details (email, telephone number)
    • Billing and shipping addresses
    • Payment information (processed securely by third-party payment gateways)

2. Technical Information

    • IP address, browser type, device details, and operating system
    • Usage data, including pages visited, time spent on pages, and interaction patterns

3. Cookies and Tracking Technologies

We use cookies to enhance your browsing experience, analyze site traffic, and improve our services. You can control cookie settings through your browser preferences.

How We Use Your Information

We use the collected information for the following purposes:
    • To process and fulfill your orders and requests
    • To manage your account and membership
    • To communicate with you about transactions, support, and updates
    • To improve our website and services through analytics and performance monitoring
    • To comply with applicable laws, regulations, and legal obligations

Data Sharing and Disclosure

We do not sell your personal data. However, we may share your information with trusted third-party service providers, strictly for operational purposes, including:
    • Payment processing services
    • Shipping and logistics providers
    • Website hosting providers
    • Marketing and analytics platforms
We ensure all third parties maintain confidentiality and data protection standards aligned with GDPR.

Data Security and Protection

We implement industry-standard security measures to protect your personal information from unauthorized access, disclosure, or misuse. Although we strive to maintain secure systems, no method of electronic storage or transmission is completely secure; thus, we cannot guarantee absolute security.

Retention of Data

Your personal data is stored only for as long as necessary to fulfill the purposes outlined above or to comply with legal obligations. Data retention periods vary according to legal and regulatory requirements.

Your Rights under GDPR

As an individual located within the EU/UK, you have specific rights regarding your personal data:
    • Right to Access: You can request access to your personal data.
    • Right to Rectification: You can request correction of inaccurate data.
    • Right to Erasure: You may request deletion of your personal data.
    • Right to Restriction: You may request limitation of data processing.
    • Right to Object: You can object to certain processing activities.
    • Right to Data Portability: You can request the transfer of your data to another service provider.
To exercise any of these rights, please contact us at info@wolverinepeptides.co.uk.

External Links

Our website may contain links to third-party websites. Please be aware that we are not responsible for the privacy practices or content of external sites. We encourage you to review their respective privacy policies.

Changes to This Privacy Policy

We reserve the right to update this Privacy Policy periodically. Changes will be posted directly on this page, and the "Last updated" date will be revised. We recommend regularly reviewing this policy to stay informed.

Contact Us

If you have any questions or concerns about this Privacy Policy or our data handling practices, please contact us at: Email: info@wolverinepeptides.co.uk
Save settings
Cookies settings

Age Verification

For verification, please enter your date of birth and email address to confirm you are 18 or older.