Sermorelin Acetate 5mg
Endocrine Research with High-Purity Sermorelin Acetate
5MG
High-purity Sermorelin Acetate (5mg) in lyophilised form, water-soluble and ideal for hormone-related research. For laboratory use only—not for human consumption. Store refrigerated or frozen. Discreet UK-based shipping worldwide.
£34.99
Highest purity verified. Ships fast and Discreetly from the U.K.
Multi-Buy Discounts
- 5 or more: 5.9% off
- 10 or more: 11.8% off
- 25 or more: 17.7% off
- 50 or more: 23.6% off
Explore Endocrine Research with High-Purity Sermorelin Acetate – 5mg
Sermorelin Acetate is a synthetic peptide analogue of growth hormone–releasing hormone (GHRH), designed for advanced research into pituitary function, hormone signaling, and endocrine regulation. With a purity of ≥98%, this peptide provides consistent reliability for high-level laboratory investigations.
✅ ≥98% Purity – Research Grade
🔬 Designed for Endocrinology and Hormonal Pathway Studies
🧪 Precision-Manufactured Lyophilised Peptide
Product Details:
• Name: Sermorelin Acetate
• Quantity: 5mg
• Catalogue Number: UKSERM2
• Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S
• Molecular Weight: 3358.9 g/mol
• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ (acetate salt)
• Form: Lyophilised Solid
Storage & Handling:
Sermorelin Acetate is supplied as a stable lyophilised powder to maintain integrity and maximize shelf life. Please consult our detailed guidelines for reconstitution and storage.
Note: This product is strictly for laboratory research use only. Not for human consumption or clinical application.
Mixing Guide
Sermorelin Acetate Mixing Guide
1ml sterile water = 10 x 0.1ml / 500mcg
2ml sterile water = 20 x 0.1ml / 250mcg
5mg = 5000mcg
Research
This section provides general information on the properties and potential applications of peptides for research purposes only. We encourage researchers to explore available studies and resources to expand their understanding. Please note that all products are strictly not intended for human consumption or clinical use. We strongly recommend consulting with qualified professionals and conducting independent research before use in any laboratory setting.
Usage
This product is intended as a research chemical, and is limited to scientific research and education only. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mis-labled as a drug, food or cosmetic.
Leave a review
Leave us a review and recieve a 20% off discount code!
Reviews
The whole process of ordering through wolverine peptides was excellent. Fast delivery, quality products and the stack included everything you would need!
Would absolutely recommend ordering this stack!
Excellent product and service. Fast shipping, well-packaged, and arrived in perfect condition. Very satisfied and will definitely order again!
I heard good recommendations about the peptides on this website.
I’m based in US and because of the high quality of the products I will be ordering from here.
Also they are very helpful if you have a question .
MN,Colorado,US.
.
I ordered the BPC-157 and the Retatrutide. Everything came well packaged, and the products were of high quality. Thanks!
best product
Fast shipping, secure and discreet packaging, really happy with the products, great vaue.
Arrived promptly and great quality.
Thanks!
Excellent quality and fast shipping. Everything arrived well-packaged and exactly as described.
Great experience from start to finish. Easy ordering process and top-notch customer service.
Related Products
Product Stacks
Best Seller!
Comprehensive Peptide Stack for Research
Includes 4x BPC-157, 4x TB-500, 2x Peptide Mixing Water, 15 syringes, and 15 alcohol wipes for comprehensive laboratory research use.
Original price was: £151.82.£139.99Current price is: £139.99.
Advanced Peptide Stack for Research
Includes 3x BPC-157, 3x TB-500, 1x Peptide Mixing Water, 10 syringes, and 10 alcohol wipes—ideal for advanced laboratory studies.
Original price was: £110.89.£99.99Current price is: £99.99.
Basic Peptide Stack for Research
Includes 2x BPC-157, 2x TB-500, 1x Peptide Mixing Water, 5 syringes, and 5 alcohol wipes for advanced laboratory research.
Original price was: £75.91.£68.49Current price is: £68.49.
Regenerative & Cosmetic Peptide Stack for Research
Includes 2x BPC-157, 2x TB-500, 2x GHK-Cu, 2x Peptide Mixing Water, 10 syringes, and 10 alcohol wipes for regenerative and cosmetic research.
Original price was: £166.34.£129.74Current price is: £129.74.