
High-purity Sermorelin Acetate (5mg) in lyophilised form, water-soluble and ideal for hormone-related research. For laboratory use only—not for human consumption. Store refrigerated or frozen. Discreet UK-based shipping worldwide.
£34.99
Sermorelin Acetate is a synthetic peptide analogue of growth hormone–releasing hormone (GHRH), designed for advanced research into pituitary function, hormone signaling, and endocrine regulation. With a purity of ≥98%, this peptide provides consistent reliability for high-level laboratory investigations.
✅ ≥98% Purity – Research Grade
🔬 Designed for Endocrinology and Hormonal Pathway Studies
🧪 Precision-Manufactured Lyophilised Peptide
Product Details:
• Name: Sermorelin Acetate
• Quantity: 5mg
• Catalogue Number: UKSERM2
• Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S
• Molecular Weight: 3358.9 g/mol
• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ (acetate salt)
• Form: Lyophilised Solid
Storage & Handling:
Sermorelin Acetate is supplied as a stable lyophilised powder to maintain integrity and maximize shelf life. Please consult our detailed guidelines for reconstitution and storage.
Note: This product is strictly for laboratory research use only. Not for human consumption or clinical application.
This product is intended as a research chemical, and is limited to scientific research and education only. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mis-labled as a drug, food or cosmetic.
Awesome product
Valeur sur 😏
Great work, keep it up!
Great packaging, good product, will buy again
2 weeks inland great so far
High end, professional wrapped, fast delivery, will use again.
Fast shipping , got delivered to Nz within a week , can’t wait to start the process an see how well they work .
Great quality with fast delivery
Excellent quality products with fast delivery
High end professional great stuff
£151.82 Original price was: £151.82.£139.99Current price is: £139.99.
£166.34 Original price was: £166.34.£129.74Current price is: £129.74.
£110.89 Original price was: £110.89.£99.99Current price is: £99.99.
£75.91 Original price was: £75.91.£68.49Current price is: £68.49.
£147.64 Original price was: £147.64.£132.99Current price is: £132.99.
£259.98 Original price was: £259.98.£241.78Current price is: £241.78.
| Cookie name | Active |
|---|---|
| eu_cookies_bar | |
| eu_cookies_bar_block | |
Wolverine is expanding. We’re opening the door to a limited number of global partners who want to build, operate and grow under the Wolverine banner using a proven model and established supply chain.
This is not a passive investment. We’re looking for driven operators, business owners and teams who understand their local market and want to build something serious with long-term brand value.
Entrepreneurs, operators and established businesses ready to develop a regional presence under the Wolverine brand. Experience in e-commerce, distribution, fitness, research supply or digital marketing is an advantage but not essential.
Complete the form below to register your interest.
Our team will review all submissions and contact suitable partners to discuss territory availability and next steps.
For verification, please enter your date of birth and email address to confirm you are 18 or older.