
High-purity Sermorelin Acetate (5mg) in lyophilised form, water-soluble and ideal for hormone-related research. For laboratory use only—not for human consumption. Store refrigerated or frozen. Discreet UK-based shipping worldwide.
£34.99
Sermorelin Acetate is a synthetic peptide analogue of growth hormone–releasing hormone (GHRH), designed for advanced research into pituitary function, hormone signaling, and endocrine regulation. With a purity of ≥98%, this peptide provides consistent reliability for high-level laboratory investigations.
✅ ≥98% Purity – Research Grade
🔬 Designed for Endocrinology and Hormonal Pathway Studies
🧪 Precision-Manufactured Lyophilised Peptide
Product Details:
• Name: Sermorelin Acetate
• Quantity: 5mg
• Catalogue Number: UKSERM2
• Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S
• Molecular Weight: 3358.9 g/mol
• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ (acetate salt)
• Form: Lyophilised Solid
Storage & Handling:
Sermorelin Acetate is supplied as a stable lyophilised powder to maintain integrity and maximize shelf life. Please consult our detailed guidelines for reconstitution and storage.
Note: This product is strictly for laboratory research use only. Not for human consumption or clinical application.
This product is intended as a research chemical, and is limited to scientific research and education only. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mis-labled as a drug, food or cosmetic.
Fast shipping, secure and discreet packaging, really happy with the products, great vaue.
Arrived promptly and great quality.
Thanks!
Excellent quality and fast shipping. Everything arrived well-packaged and exactly as described.
Great experience from start to finish. Easy ordering process and top-notch customer service.
Impressed with the purity and consistency of the products. Definitely recommended for research purposes.
Reliable supplier with quick delivery and professional packaging. Will order again.
Fantastic service—products are always well-sealed and shipped discreetly. Never had an issue.
High-quality materials, excellent communication, and smooth transactions every time.
Very happy with the product quality and fast turnaround. Exactly what I needed for my research.
Clear labelling, professional packaging, and dependable shipping. Highly recommend.
£151.82 Original price was: £151.82.£139.99Current price is: £139.99.
£110.89 Original price was: £110.89.£99.99Current price is: £99.99.
£75.91 Original price was: £75.91.£68.49Current price is: £68.49.
£166.34 Original price was: £166.34.£129.74Current price is: £129.74.
Cookie name | Active |
---|---|
woocommerce_cart_hash | |
wp_woocommerce_session_68d5d32e3852c170f425ad13ac45768d |