
High-purity Sermorelin Acetate (5mg) in lyophilised form, water-soluble and ideal for hormone-related research. For laboratory use only—not for human consumption. Store refrigerated or frozen. Discreet UK-based shipping worldwide.
£34.99
101 in stock
Sermorelin Acetate is a synthetic peptide analogue of growth hormone–releasing hormone (GHRH), designed for advanced research into pituitary function, hormone signaling, and endocrine regulation. With a purity of ≥98%, this peptide provides consistent reliability for high-level laboratory investigations.
✅ ≥98% Purity – Research Grade
🔬 Designed for Endocrinology and Hormonal Pathway Studies
🧪 Precision-Manufactured Lyophilised Peptide
Product Details:
• Name: Sermorelin Acetate
• Quantity: 5mg
• Catalogue Number: UKSERM2
• Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S
• Molecular Weight: 3358.9 g/mol
• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ (acetate salt)
• Form: Lyophilised Solid
Storage & Handling:
Sermorelin Acetate is supplied as a stable lyophilised powder to maintain integrity and maximize shelf life. Please consult our detailed guidelines for reconstitution and storage.
Note: This product is strictly for laboratory research use only. Not for human consumption or clinical application.
This product is intended as a research chemical, and is limited to scientific research and education only. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mis-labled as a drug, food or cosmetic.
Great quality with fast delivery
Excellent quality products with fast delivery
High end professional great stuff
Arrived promptly and great quality.
Thanks!
Excellent quality and fast shipping. Everything arrived well-packaged
Great experience. I live in the US and my order came in 5 days. I will be reordering when needed.
The whole process of ordering through wolverine peptides was excellent. Fast delivery, quality products and the stack included everything you would need!
Would absolutely recommend ordering this stack!
Excellent product and service. Fast shipping, well-packaged, and arrived in perfect condition. Very satisfied and will definitely order again!
I heard good recommendations about the peptides on this website.
I’m based in US and because of the high quality of the products I will be ordering from here.
Also they are very helpful if you have a question .
MN,Colorado,US.
.
£151.82 Original price was: £151.82.£139.99Current price is: £139.99.
£166.34 Original price was: £166.34.£129.74Current price is: £129.74.
£110.89 Original price was: £110.89.£99.99Current price is: £99.99.
£75.91 Original price was: £75.91.£68.49Current price is: £68.49.
£147.64 Original price was: £147.64.£132.99Current price is: £132.99.
| Cookie name | Active |
|---|
Wolverine is expanding. We’re opening the door to a limited number of global partners who want to build, operate and grow under the Wolverine banner using a proven model and established supply chain.
This is not a passive investment. We’re looking for driven operators, business owners and teams who understand their local market and want to build something serious with long-term brand value.
Entrepreneurs, operators and established businesses ready to develop a regional presence under the Wolverine brand. Experience in e-commerce, distribution, fitness, research supply or digital marketing is an advantage but not essential.
Complete the form below to register your interest.
Our team will review all submissions and contact suitable partners to discuss territory availability and next steps.
For verification, please enter your date of birth and email address to confirm you are 18 or older.